human PlGF-1 protein Human 5 µg

In stock

Cat-Nr.
300-015
Size
5 µg
  €190.00

Description / human PlGF-1 protein

Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversial. In several reports it was shown not to be a potent mitogen for endothelial cells and not angiogenic in vivo by using different assays. Very recently it was shown by one investigator, that PlGF-1 from cell culture supernatants was angiogenic in the CAM assay and in the rabbit cornea assay. At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes) but PlGF does not bind to KDR/flk-1. Two different proteins can be generated by differential splicing of the human PlGF gene: PlGF-1 (131aa native chain) and PlGF-2 (152aa native chain). Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF-1 is a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms posses a similar biological profile. There is good evidence that heterodimeric molecules between VEGF and PlGF exists and that they are biological active. Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A closely related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.

More Information

Size 5 µg
Source Insect cells
Biological Activity Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human PlGF-1 can bind to immobilized rh-sFlt-1 (100ng/well) with a linear range at 0.5 - 10ng/ml.
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 131
Molecular Weight ~ 34.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 50mM acetic acid
Protein Sequence LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR
Reconstitution Centrifuge vial prior to opening. The PlGF-1 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use
Stability and Storage The lyophilized human PlGF-1, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C. Avoid repeated freeze-thaw cycles.
Synonyms PlGF; placental growth factor
Uniprot ID P49763
Protein RefSeq NP_001193941.1
mRNA RefSeq NM_001207012.1

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M67
€190.00

In stock

SKU: 101-M69
€190.00

In stock

SKU: 102-P248
€271.00

In stock

SKU: 102-PA04
€310.00

In stock

SKU: 102-PA01
€310.00

In stock

All prices plus VAT + possible delivery charges