human PDGF-AA protein Human 2 µg

In stock

Cat-Nr.
200-051S
Size
2 µg
€61.00

Description / human PDGF-AA protein

PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AA is a 28.5 kDa disulfide-linked homodimer of two A chains (250 total amino acids).

More Information

Size 2 µg
Source E. coli
Biological Activity The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
N Terminal Sequence SIEEAVPA
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 125
Molecular Weight 28.5 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 50mM acetic acid
Protein Sequence SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Reconstitution Centrifuge vial prior to opening. The lyophilized PDGF-AA should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Stability and Storage The lyophilized PDGF-AA is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-AA is best stored at -20°C to -70°C. Avoid repeated freeze-thaw cycles.
Synonyms PDGFA; PDGF1; PDGF-A
Uniprot ID P04085
Protein RefSeq NP_002598.5
mRNA RefSeq NM_002607.5

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M44
€453.00

In stock

SKU: 101-M821
€453.00

In stock

SKU: 102-P77
€283.00

In stock

All prices plus VAT + possible delivery charges