human p16-INK4a protein Human 20 µg

In stock

Cat-Nr.
100-421
Size
20 µg
  €221.00

Description / human p16-INK4a protein

p16-INK4a is a nuclear protein that regulates the cell cycle by inhibiting cyclin dependent kinase-4 (CDK4) and CDK6. p16-INK4a inhibits CDK activity by binding to the CDK molecules in a manner that interferes with their ability to interact with cyclin D. This activity has the effect of suppressing tumor formation and growth, and of inducing replicative senescence in various normal cells, including stem cells. The expression of p16-INK4a steadily increases with age and tends to accumulate in stem cell compartments. The deletion, rearrangement, or mutation of the p16-INK4a gene is frequently found in melanomas as well as in certain other types of cancer. Recombinant p16-INK4a is a 16.5 kDa protein containing 156 amino acid residues.

More Information

Size 20 µg
Source E. coli
Biological Activity Data not available.
Purity Confirmation > 95% by SDS-PAGE & HPLC analyses
Length [aa] 156
Molecular Weight 16.5 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Synonyms Cyclin-dependent kinase inhibitor 2A, Cyclin-dependent kinase 4 inhibitor A, CDK4I, MTS-1, Multiple tumor suppressor 1
Uniprot ID P42771
Protein RefSeq NP_478104.2
mRNA RefSeq NM_058197.4

All prices plus VAT + possible delivery charges