human OX40 ligand, soluble protein Human 100 µg

Cat-Nr.
S01-052-L100
Size
100 µg
€1,145.00

Description / human OX40 ligand, soluble protein

OX40L, a member of the TNF superfamily of structurally related proteins, exists primarily as a type II membrane bound, non-covalently linked homotrimeric protein. It is expressed on antigen presenting cells (APCs), such as dendritic cells and activated B-cells, and also on various other cells such as vascular endothelial cells, mast cells, and natural killer cells. OX40L signals specifically through the OX40 receptor, which is expressed predominantly on CD4+T cells but also on certain activated CD8+T cells. OX40/OX40L functions as a costimulatory signal, which is required for a productive interaction between antigen presenting cells and their target T-cells. It enhances cell proliferation and survival, and increases expression of RANTES, IL-2, IL-3, and IFNγ. OX40/OX40L signaling plays an important role in immuno-regulatory communication, enabling the immune system to distinguish between “friend vs. foe” during activation; a mechanism typically termed immuno-tolerance. Recombinant OX40L is a glycosylated 133 amino acid protein corresponding to the extracellular TNF homologous domain of the full length transmembrane protein. It migrates with an apparent molecular mass of 15.5 – 25.0 kDa on SDS-PAGE.

More Information

Size 100 µg
Source Insect cells
Biological Activity Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/ml. Note: Results may vary with PBMC donors.
Purity Confirmation > 97% by SDS-PAGE & HPLC analyses
Endotoxin < 0.1 ng/µg of protein (< 1 EU/µg)
Length [aa] 133
Molecular Weight 15.5-25 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Synonyms TNFSF4; GP34; CD252; OX4OL; TXGP1; CD134L; OX-40L; TAX transcriptionally-activated glycoprotein 1
Uniprot ID P23510
Protein RefSeq NP_003317.1
mRNA RefSeq NM_003326.3

All prices plus VAT + possible delivery charges