Description / pleurotus ostreatus Ostreolysin (Cytolysin) protein
Ostreolysin, is a cytosolic protein of 15 kDa pore-forming protein from the edible oyster mushroom (Pleurotus ostreatus), is lytic to membranes containing both cholesterol and sphingomyelin. Its cytotoxicity to Chinese hamster ovary cells correlates with their cholesterol contents and with the occurrence of ostreolysin in the cells detergent resistant membranes. Moreover, ostreolysin binds to supported monolayers and efficiently permeabilizes sonicated lipid vesicles, only if cholesterol is combined with either sphingomyelin or dipalmitoyl-phosphatidylcholine. Addition of mono- or di-unsaturated phosphatidylcholine to the cholesterol/sphingomyelin vesicles dramatically reduces the ostreolysin's activity. It appears that the protein recognizes specifically a cholesterol-rich lipid phase, probably the liquid-ordered phase. Ostreolysin was purified by combination of ion-exchange and size-exclusion chromatography.
More Information
| Size | 50 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Ostreolysin has potent anti-carcinogenic activity in several colon cancer cell lines. |
| N Terminal Sequence | AYAQWV |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 137 |
| Molecular Weight | 14.9 kDa |
| Species Reactivity | Oyster mushroom |
| Formulation | lyophilized |
| Protein Sequence | AYAQWVIIIIHNVGSQDVKIKNLKASWGKLHADGDKDAEVSASNYEGKIVKPDEKLQINACGRSDAAEGTTGTFDLVDPADGDKQVRHFYWDCPWGSKTNTWTVSGSNTKWMIEYSGQNLDSGALGTITVDTLKKGN |
| Reconstitution | It is recommended to reconstitute the lyophilized ostreolysin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Ostreolysin A6 |
| Uniprot ID | P83467 |
| Protein RefSeq | AGH25589.1 |
| mRNA RefSeq | KC012711.1 |