pleurotus ostreatus Ostreolysin (Cytolysin) protein Pleurotus ostreatus 5 µg

In stock

Cat-Nr.
500-076
Size
5 µg
€255.00

Description / pleurotus ostreatus Ostreolysin (Cytolysin) protein

Ostreolysin, is a cytosolic protein of 15 kDa pore-forming protein from the edible oyster mushroom (Pleurotus ostreatus), is lytic to membranes containing both cholesterol and sphingomyelin. Its cytotoxicity to Chinese hamster ovary cells correlates with their cholesterol contents and with the occurrence of ostreolysin in the cells detergent resistant membranes. Moreover, ostreolysin binds to supported monolayers and efficiently permeabilizes sonicated lipid vesicles, only if cholesterol is combined with either sphingomyelin or dipalmitoyl-phosphatidylcholine. Addition of mono- or di-unsaturated phosphatidylcholine to the cholesterol/sphingomyelin vesicles dramatically reduces the ostreolysin's activity. It appears that the protein recognizes specifically a cholesterol-rich lipid phase, probably the liquid-ordered phase. Ostreolysin was purified by combination of ion-exchange and size-exclusion chromatography.

More Information

Size 5 µg
Source E. coli
Biological Activity Ostreolysin has potent anti-carcinogenic activity in several colon cancer cell lines.
N Terminal Sequence AYAQWV
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 137
Molecular Weight 14.9 kDa
Species Reactivity Oyster mushroom
Formulation lyophilized
Protein Sequence AYAQWVIIIIHNVGSQDVKIKNLKASWGKLHADGDKDAEVSASNYEGKIVKPDEKLQINACGRSDAAEGTTGTFDLVDPADGDKQVRHFYWDCPWGSKTNTWTVSGSNTKWMIEYSGQNLDSGALGTITVDTLKKGN
Reconstitution It is recommended to reconstitute the lyophilized ostreolysin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Ostreolysin A6
Uniprot ID P83467
Protein RefSeq AGH25589.1
mRNA RefSeq KC012711.1

All prices plus VAT + possible delivery charges