human Osteoprotegerin (OPG) protein Human 50 µg

In stock

Cat-Nr.
100-089
Size
50 µg
€217.00

Description / human Osteoprotegerin (OPG) protein

Osteoprotegerin (OPG) is a member of the TNFR superfamily that can act as a decoy receptor for RANKL. Binding of soluble OPG to sRANKL inhibits osteoclastogenesis by interrupting the signaling between stromal cells and osteoclastic progenitor cells, thereby leading to excess accumulation of bone and cartilage. OPG is expressed in a wide variety of tissues including adult heart, lung, kidney, liver, spleen, prostate, lymph node and bone marrow. OPG is secreted both as a monomeric and a dimeric protein. Its primary structure consists of seven distinct domains, four of which corresponds to the extracellular cysteine-rich domains of TNFR proteins and constitutes the soluble OPG. Recombinant human OPG is a soluble 20.0 kDa protein containing 174 amino acid residues.

More Information

Size 50 µg
Source E. coli
Biological Activity Determined by its ability to neutralize the stimulation of U937 cells treated with 10 ng/ml of soluble RANKL (sRANKL).
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 174
Molecular Weight 20 kDa
Species Reactivity Mouse, Rat, Human
Formulation lyophilized
Protein Sequence METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK
Synonyms TNFRSF11B; OPG; TR1; OCIF
Uniprot ID O00300
Protein RefSeq NP_002537.3
mRNA RefSeq NM_002546.3

All prices plus VAT + possible delivery charges