human NRP-1, soluble protein (His-Tag) Human 25 µg
Description / human NRP-1, soluble protein (His-Tag)
Neuropilin-1 (NRP-1, CD304) is a 130-140 kDa type I transmembrane glycoprotein that regulates axon guidance and angiogenesis. The human NRP-1 contains a 623 aa extracellular domain (ECD) that shows 92-95% aa identity with mouse, rat, bovine and canine NRP-1. The ECD contains two N-terminal CUB domains (termed a1a2), two domains with homology to coagulation factors V and VIII (b1b2) and a MAM (meprin) domain. C-terminally divergent splice variants with 704, 644, 609, and 551 aa lack the MAM and TM domains and are demonstrated or presumed to be soluble antagonists. Heparin, the heparin-binding forms of VEGF (VEGF165, VEGF-B; VEGF-E), PlGF-2, and the C-terminus of Sema3 bind the b1b2 region. NRP-1 and NRP-2 share 48% aa identity within the ECD and can form homo and hetero-oligomers via interaction of their MAM domains. Neuropilins show partially overlapping expression in neuronal and endothelial cells during development. Both neuropilins act as coreceptors with Plexins, mainly Plexin A3 and A4, to bind class III Semaphorins that mediate axon repulsion. However, only NRP-1 binds Sema3A, and only NRP-2 binds Sema 3F. Both are co-receptors with VEGFR-2 (KDR7Flk1) for VEGF165 binding. Sema 3A signaling can be blocked by VEGF165, which has higher affinity for NRP-1. NRP-1 is preferentially expressed in arteries during development or those undergoing remodeling. NRP-1 is also expressed on dendritic cells and mediates DC-induced T-cell proliferation
More Information
| Size | 25 µg |
|---|---|
| Source | Insect cells |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized soluble Neuropilin-1 binds all VEGF-A isoforms with the exception of VEGF121. |
| N Terminal Sequence | FRNDKCGDTI |
| Purity Confirmation | ≥ 95% by SDS-PAGE |
| Length [aa] | 631 |
| Molecular Weight | 82.6 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCM |
| Reconstitution | The lyophilized human sNRP-1 is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100µg/ml. |
| Synonyms | Neuropilin receptor-1, VEGF165R, NRP, CD304; neuropilin |
| Uniprot ID | O14786 |
| Protein RefSeq | NP_003864.4 |
| mRNA RefSeq | NM_003873.5 |

