human Lyve-1, soluble protein (His-Tag) Human 20 µg

In stock

Cat-Nr.
S01-028
Size
20 µg
€88.00

Description / human Lyve-1, soluble protein (His-Tag)

A DNA sequence encoding the extracellular domain of human LYVE-1 (Met1 to Gly232) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ser24. sLYVE-1 has a calculated monomeric molecular mass of about 25 kDa but as a result of glycosylation, migrates at approximately 35 - 45 kDa under reducing conditions in SDS-PAGE. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.

More Information

Size 20 µg
Source Insect cells
N Terminal Sequence SLRAEELSI
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 215
Molecular Weight ~ 35.0 - 45.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence SLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGHHHHHH
Reconstitution The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
Stability and Storage lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!
Synonyms LYVE1; HAR; XLKD1; LYVE-1; CRSBP-1
Uniprot ID Q9Y5Y7
Protein RefSeq NP_006682
mRNA RefSeq NM_006691

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M130
€453.00

In stock

SKU: 102-PA50
€316.00

In stock

SKU: 102-PA50AG
€193.00

In stock

All prices plus VAT + possible delivery charges