mouse LIF protein Mouse 50 µg

In stock

Cat-Nr.
M30-008
Size
50 µg
  €316.00

Description / mouse LIF protein

Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence. Human LIF is as active on human cells as is it is on mouse cells, though mouse LIF is about 1000 fold less active on human cells, than human LIF. Recombinant mouse LIF produced in E. coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a molecular mass of 19.86 kDa.

More Information

Size 50 µg
Source E. coli
Biological Activity The ED50 as determined by the M1 cell differentiation assay is in the range of 0.1 - 0.5 ng/ml.
N Terminal Sequence SPLPIT
Purity Confirmation > 98% by SDS-PAGE
Length [aa] 180
Molecular Weight 19.86 kDa
Species Reactivity Mouse
Formulation lyophilized
Buffer 0.5X PBS
Protein Sequence SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Reconstitution The lyophilized LIF should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
Stability and Storage The lyophilized LIF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted LIF should be stored in working aliquots at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Synonyms Lif; leukemia inhibitory factor
Uniprot ID P09056
Protein RefSeq NP_032527
mRNA RefSeq NM_008501

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-PA05
€316.00

In stock

SKU: 103-M263
€453.00

In stock

All prices plus VAT + possible delivery charges