human Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein Human 1000 µg

In stock

Cat-Nr.
500-044-L1000
Size
1000 µg
  €1,783.00

Description / human Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein

Recombinant super human leptin antagonist is one polypeptide chain containing 146 amino. Super human leptin antagonist (SHLA) was initially mutated, resulting in D23L/L39A/D40A/F41A super human leptin antagonist that was purified by proprietary chromatographic techniques. More details can be found in Shpilman at al., J. Biol. Chem. 286:4439-42 (2011).

More Information

Size 1000 µg
Source E. coli
Biological Activity Super human leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Super human leptin antagonist also inhibits various leptin effects in several in vitro bioas
N Terminal Sequence AVPIQ
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence AVPIQKVQDDTKTLIKTIVTRINLISHTQSVSSKQKVTGAAAAPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Reconstitution It is recommended to reconstitute the lyophilized super human leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
Synonyms Lep; ob; obese
Uniprot ID P41159
Protein RefSeq NP_000221.1
mRNA RefSeq NM_000230

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M550
€453.00

In stock

SKU: 101-M74
€183.00

In stock

SKU: 102-PA135
€316.00

In stock

All prices plus VAT + possible delivery charges