ovine Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein Ovine 10 µg

In stock

Cat-Nr.
500-068S
Size
10 µg
€181.00

Description / ovine Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein

Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, was mutated, resulting in D23L/L39A/D40A/F41A mutant termed recombinant super active ovine leptin antagonist that was purified by proprietary chromatographic techniques.

More Information

Size 10 µg
Source E. coli
Biological Activity Recombinant super active ovine leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays. Th
N Terminal Sequence AVPIR
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Ovine
Formulation lyophilized
Protein Sequence AVPIRKVQDDTKTLIKTIVTRINLISHTQSVSSKQRVTGAAAAPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
Reconstitution It is recommended to reconstitute the lyophilized recombinant super active ovine leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 10, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
Synonyms Lep; ob; obese
Protein RefSeq XP_027824581.2
mRNA RefSeq XM_027968780.2

All prices plus VAT + possible delivery charges