rat Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein Rat 10 µg

In stock

Cat-Nr.
500-055S
Size
10 µg
€181.00

Description / rat Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein

Recombinant super rat leptin antagonist is one polypeptide chain containing 146 amino. Super rat leptin antagonist (SRLA) was initially mutated, resulting in D23L/L39A/D40A/F41A super rat leptin antagonist that was purified by proprietary chromatographic techniques. The procedure was similar to that described in in Shpilman at al., J. Biol. Chem. 286:4439-42 (2011) for mouse super leptin antagonist.

More Information

Size 10 µg
Source E. coli
Biological Activity Super rat leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Super rat leptin antagonist also inhibits various leptin effects in several in vitro bioassays
N Terminal Sequence AVPIQ
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Rat
Formulation lyophilized
Protein Sequence AVPIHKVQDDTKTLIKTIVTRINLISHTQSVSARQRVTGAAAIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
Reconstitution It is recommended to reconstitute the lyophilized super rat leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
Synonyms Lep; ob; obese
Uniprot ID P50596
Protein RefSeq NP_037208
mRNA RefSeq NM_013076

All prices plus VAT + possible delivery charges