mouse Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein Mouse 100 µg

In stock

Cat-Nr.
500-050
Size
100 µg
  €846.00

Description / mouse Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein

Recombinant mouse leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, mLEP was mutated, resulting in D23L/L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques.

More Information

Size 100 µg
Source E. coli
Biological Activity Recombinant mouse super-active leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Mouse super-active leptin antagonist also inhibits various leptin effects
N Terminal Sequence AVPIQ
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Mouse
Formulation lyophilized
Protein Sequence AVPIQKVQDDTKTLIKTIVTRINLISHTQSVSAKQRVTGAAAIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Reconstitution It is recommended to reconstitute the lyophilized mouse super-active leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
Synonyms Lep; ob; obese
Uniprot ID P41160
Protein RefSeq NP_032519.1
mRNA RefSeq NM_008493.3

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-P24
€283.00

In stock

All prices plus VAT + possible delivery charges