Description / human Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein
Recombinant super human leptin antagonist is one polypeptide chain containing 146 amino. Super human leptin antagonist (SHLA) was initially mutated, resulting in D23L/L39A/D40A/F41A super human leptin antagonist that was purified by proprietary chromatographic techniques. More details can be found in Shpilman at al., J. Biol. Chem. 286:4439-42 (2011).
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Super human leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Super human leptin antagonist also inhibits various leptin effects in several in vitro bioas |
| N Terminal Sequence | AVPIQ |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINLISHTQSVSSKQKVTGAAAAPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Reconstitution | It is recommended to reconstitute the lyophilized super human leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Uniprot ID | P41159 |
| Protein RefSeq | NP_000221.1 |
| mRNA RefSeq | NM_000230 |