human Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein Human 10 µg

In stock

Cat-Nr.
500-044S
Size
10 µg
€181.00

Description / human Leptin super antagonist (mutant D23L/L39A/D40A/F41A) protein

Recombinant super human leptin antagonist is one polypeptide chain containing 146 amino. Super human leptin antagonist (SHLA) was initially mutated, resulting in D23L/L39A/D40A/F41A super human leptin antagonist that was purified by proprietary chromatographic techniques. More details can be found in Shpilman at al., J. Biol. Chem. 286:4439-42 (2011).

More Information

Size 10 µg
Source E. coli
Biological Activity Super human leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Super human leptin antagonist also inhibits various leptin effects in several in vitro bioas
N Terminal Sequence AVPIQ
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence AVPIQKVQDDTKTLIKTIVTRINLISHTQSVSSKQKVTGAAAAPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Reconstitution It is recommended to reconstitute the lyophilized super human leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
Synonyms Lep; ob; obese
Uniprot ID P41159
Protein RefSeq NP_000221.1
mRNA RefSeq NM_000230

All prices plus VAT + possible delivery charges