ovine Leptin pegylated super antagonist (mutant D23L/L39A/D40A/F41A) protein Ovine 5 µg

In stock

Cat-Nr.
500-069S
Size
5 µg
€181.00

Description / ovine Leptin pegylated super antagonist (mutant D23L/L39A/D40A/F41A) protein

Mono-pegylated (with 20 kDa PEG) recombinant super active ovine leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume pegylated recombinant super active ovine leptin antagonist runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. The half-life in circulation of pegylated recombinant super active ovine leptin antagonist after SC injection was over 20 hours. Recombinant super active ovine leptin antagonist was initially mutated, resulting in D23L/L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques. The pegylation of recombinant super active ovine leptin antagonist is similar to that described in Elinav et al. Endocrinology 150:3083-91 (2009) for pegylated recombinant super active mouse leptin antagonist

More Information

Size 5 µg
Source E. coli
Biological Activity Pegylated recombinant super active ovine leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. The in vitro activity of pegylated recombinant super active ovi
N Terminal Sequence AVPIR
Purity Confirmation > 95.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 35.6 kDa
Species Reactivity Ovine
Formulation lyophilized
Protein Sequence AVPIRKVQDDTKTLIKTIVTRINLISHTQSVSSKQRVTGAAAAPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
Reconstitution It is recommended to reconstitute the lyophilized pegylated recombinant super active ovine leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions
Synonyms Lep; ob; obese
Protein RefSeq XP_027824581.2
mRNA RefSeq XM_027968780.2

All prices plus VAT + possible delivery charges