Description / rat Leptin pegylated super antagonist (mutant D23L/L39A/D40A/F41A) protein
Mono-pegylated (with 20 kDa PEG) recombinant super rat leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume human pegylated leptin antagonist runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Its half-life in circulation after SC injection was over 20 hours. Super rat leptin antagonist (SRLA) was initially mutated, resulting in D23L/L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques. Pegylation of human leptin antagonist similar to that described in Elinav et al. Endocrinology 150:3083-91 (2009) for PEG-MLA. More details can be found in Shpilman at al., J. Biol. Chem. 286:4439-42 (2011).
More Information
| Size | 20 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Rat pegylated leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Its in vitro activity is 6-8 fold lower than the non-pegylated rat leptin antagonist but i |
| N Terminal Sequence | AVPIQ |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 35.6 kDa |
| Species Reactivity | Rat |
| Formulation | lyophilized |
| Protein Sequence | AVPIHKVQDDTKTLIKTIVTRINLISHTQSVSARQRVTGAAAIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC |
| Reconstitution | It is recommended to reconstitute the lyophilized rat pegylated leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Uniprot ID | P50596 |
| Protein RefSeq | NP_037208 |
| mRNA RefSeq | NM_013076 |

