human Leptin pegylated super antagonist (mutant D23L/L39A/D40A/F41A) protein Human 5 µg

In stock

Cat-Nr.
500-045S
Size
5 µg
€181.00

Description / human Leptin pegylated super antagonist (mutant D23L/L39A/D40A/F41A) protein

Mono-pegylated (with 20 kDa PEG) recombinant super human leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume human pegylated leptin antagonist runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Its half-life in circulation after SC injection was over 20 hours. Super human leptin antagonist (SHLA) was initially mutated, resulting in D23L/L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques. Pegylation of human leptin antagonist similar to that described in Elinav et al. Endocrinology 150:3083-91 (2009) for PEG-MLA. More details can be found in Shpilman at al., J. Biol. Chem. 286:4439-42 (2011).

More Information

Size 5 µg
Source E. coli
Biological Activity Recombinantr human pegylated leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Its in vitro activity is 6-8 fold lower than the non-pegylated human leptin
N Terminal Sequence AVPIQ
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 35.6 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence AVPIQKVQDDTKTLIKTIVTRINLISHTQSVSSKQKVTGAAAAPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Reconstitution It is recommended to reconstitute the lyophilized human pegylated leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
Synonyms Lep; ob; obese
Uniprot ID P41159
Protein RefSeq NP_000221.1
mRNA RefSeq NM_000230

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M550
€453.00

In stock

SKU: 101-M74
€183.00

In stock

SKU: 102-PA135
€316.00

In stock

All prices plus VAT + possible delivery charges