human Leptin pegylated antagonist (mutant L39A/D40A/F41A) protein Human 5 µg
Description / human Leptin pegylated antagonist (mutant L39A/D40A/F41A) protein
Mono-pegylated (with 20 kDa PEG) recombinant human leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume recombinant human leptin antagonist runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Human pegylated recombinant leptin antagonist half-life in circulation after SC injection was over 20 hours. Human pegylated recombinant leptin antagonist was initially mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques according to Niv-Spector et al, Biochem. J 291;221-230 (2005). and its pegylation was similar to that is described in Elinav et al. for mouse leptin antagonist see Endocrinology 150:3083-91 (2009).
More Information
| Size | 5 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant human pegylated leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Its in vitro activity is 6-8 fold lower than the non-pegylated human leptin |
| N Terminal Sequence | AVPIQ |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 35.6 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGAAAIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Reconstitution | It is recommended to reconstitute the lyophilized pegylated recombinant human pegylated leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Uniprot ID | P41159 |
| Protein RefSeq | NP_000221.1 |
| mRNA RefSeq | NM_000230 |

