ovine Leptin, MTS-tagged protein Ovine 1000 µg

In stock

Cat-Nr.
500-063-L1000
Size
1000 µg
  €1,688.00

Description / ovine Leptin, MTS-tagged protein

Recombinant ovine MTS-leptin, one polypeptide chain containing 157 amino and (extra 10 amino acids of the membrane translocating sequence Val-Leu-Leu-Pro-Val-Leu-Leu-Ala-Ala-Pro) derived from Kaposi virus and additional Ala at N-terminus acids . The resulting molecular mass of is ~ 17.5 kDa, MTS-ovine leptin was purified by proprietary chromatographic techniques.

More Information

Size 1000 µg
Source E. coli
Biological Activity MTS-ovine recombinant leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. In vivo experiments has shown potency equal but not higher that non tagged ovin
N Terminal Sequence AAVLLP
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 157
Molecular Weight 17.5 kDa
Species Reactivity Ovine
Formulation lyophilized
Protein Sequence AAVLLPVLLAAPVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
Reconstitution It is recommended to reconstitute the lyophilized MTS-ovine recombinant leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Lep; ob; obese
Protein RefSeq XP_027824581.2
mRNA RefSeq XM_027968780.2

All prices plus VAT + possible delivery charges