Description / ovine Leptin, MTS-tagged protein
Recombinant ovine MTS-leptin, one polypeptide chain containing 157 amino and (extra 10 amino acids of the membrane translocating sequence Val-Leu-Leu-Pro-Val-Leu-Leu-Ala-Ala-Pro) derived from Kaposi virus and additional Ala at N-terminus acids . The resulting molecular mass of is ~ 17.5 kDa, MTS-ovine leptin was purified by proprietary chromatographic techniques.
More Information
| Size | 100 µg |
|---|---|
| Source | E. coli |
| Biological Activity | MTS-ovine recombinant leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. In vivo experiments has shown potency equal but not higher that non tagged ovin |
| N Terminal Sequence | AAVLLP |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 157 |
| Molecular Weight | 17.5 kDa |
| Species Reactivity | Ovine |
| Formulation | lyophilized |
| Protein Sequence | AAVLLPVLLAAPVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG |
| Reconstitution | It is recommended to reconstitute the lyophilized MTS-ovine recombinant leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Protein RefSeq | XP_027824581.2 |
| mRNA RefSeq | XM_027968780.2 |

