Description / human Leptin antagonist (mutant L39A/D40A/F41A/I42A) protein
Recombinant human leptin is one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Human leptin was mutated, resulting in L39A/D40A/F41A/I42A mutant which is leptin antagonist. It was purified by proprietary chromatographic techniques. Preparation of leptin antagonists was published (Niv-Spector et al, Biochem. J 291;221-230 (2005).
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant human leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays. |
| N Terminal Sequence | AVPIQ |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGAAAAPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant human leptin antagonist in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions preferably in presence of carrier protein. |
| Synonyms | Lep; ob; obese |
| Uniprot ID | P41159 |
| Protein RefSeq | NP_000221.1 |
| mRNA RefSeq | NM_000230 |

