human Leptin antagonist (mutant L39A/D40A/F41A/I42A) protein Human 50 µg

In stock

Cat-Nr.
500-043
Size
50 µg
€255.00

Description / human Leptin antagonist (mutant L39A/D40A/F41A/I42A) protein

Recombinant human leptin is one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Human leptin was mutated, resulting in L39A/D40A/F41A/I42A mutant which is leptin antagonist. It was purified by proprietary chromatographic techniques. Preparation of leptin antagonists was published (Niv-Spector et al, Biochem. J 291;221-230 (2005).

More Information

Size 50 µg
Source E. coli
Biological Activity Recombinant human leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays.
N Terminal Sequence AVPIQ
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGAAAAPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Reconstitution It is recommended to reconstitute the lyophilized recombinant human leptin antagonist in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions preferably in presence of carrier protein.
Synonyms Lep; ob; obese
Uniprot ID P41159
Protein RefSeq NP_000221.1
mRNA RefSeq NM_000230

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M550
€453.00

In stock

SKU: 101-M74
€183.00

In stock

SKU: 102-PA135
€316.00

In stock

All prices plus VAT + possible delivery charges