ovine Leptin antagonist (mutant L39A/D40A/F41A) protein Ovine 1000 µg

In stock

Cat-Nr.
500-065-L1000
Size
1000 µg
€1,496.00

Description / ovine Leptin antagonist (mutant L39A/D40A/F41A) protein

Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, oLEP was mutated, resulting in L39A/D40A/F41A mutant was purified by proprietary chromatographic techniques. Preparation of recombinant leptin antagonists was recently published - Niv-Spector et al, Biochem. J 291;221-230 (2005).

More Information

Size 1000 µg
Source E. coli
Biological Activity Ovine recombinant leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of ovine leptin receptor. It also inhibits various leptin effects in several in vitro bioassays.
N Terminal Sequence AVPIR
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Ovine
Formulation lyophilized
Protein Sequence AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGAAAIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
Reconstitution It is recommended to reconstitute the lyophilized recombinant leptin antagonist in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Lep; ob; obese
Protein RefSeq XP_027824581.2
mRNA RefSeq XM_027968780.2

All prices plus VAT + possible delivery charges