mouse Leptin antagonist (mutant L39A/D40A/F41A) protein Mouse 1000 µg

In stock

Cat-Nr.
500-048-L1000
Size
1000 µg
€1,496.00

Description / mouse Leptin antagonist (mutant L39A/D40A/F41A) protein

Recombinant mouse leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, recombinant mouse leptin was mutated, resulting in L39A/D40A/F41A antagonist that was purified by proprietary chromatographic techniques. according to Salomon et al (2006) Protein Expression and PuriWcation 47, 128–136.

More Information

Size 1000 µg
Source E. coli
Biological Activity Recombinant mouse leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays.
N Terminal Sequence AVPIQ
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Mouse
Formulation lyophilized
Protein Sequence AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGAAAIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Reconstitution It is recommended to reconstitute the lyophilized recombinant mouse leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
Synonyms Lep; ob; obese
Uniprot ID P41160
Protein RefSeq NP_032519.1
mRNA RefSeq NM_008493.3

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-P24
€283.00

In stock

All prices plus VAT + possible delivery charges