Description / mouse Leptin antagonist (mutant L39A/D40A/F41A) protein
Recombinant mouse leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, recombinant mouse leptin was mutated, resulting in L39A/D40A/F41A antagonist that was purified by proprietary chromatographic techniques. according to Salomon et al (2006) Protein Expression and PuriWcation 47, 128–136.
More Information
| Size | 1000 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant mouse leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays. |
| N Terminal Sequence | AVPIQ |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGAAAIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant mouse leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Uniprot ID | P41160 |
| Protein RefSeq | NP_032519.1 |
| mRNA RefSeq | NM_008493.3 |

