rat Leptin antagonist (mutant L39A/D40A/F41A) protein Rat 50 µg
Description / rat Leptin antagonist (mutant L39A/D40A/F41A) protein
Recombinant rat leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Recombinant rat leptin was mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques, according to Salomon et al (2006) Protein Expression and PuriWcation 47, 128–136.
More Information
| Size | 50 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant rat leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays. |
| N Terminal Sequence | AVPIQ |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| Species Reactivity | Rat |
| Formulation | lyophilized |
| Protein Sequence | AVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGAAAIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant rat leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Uniprot ID | P50596 |
| Protein RefSeq | NP_037208 |
| mRNA RefSeq | NM_013076 |

