rabbit Leptin protein Rabbit 20 µg

In stock

Cat-Nr.
500-072S
Size
20 µg
€206.00

Description / rabbit Leptin protein

Recombinant rabbit leptin, is one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Recombinant rabbit leptin was purified by proprietary chromatographic techniques, (Solomon, Charlier, Djiane and Gertler,. unpublished results)

More Information

Size 20 µg
Source E. coli
Biological Activity Recombinant rabbit leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor.
N Terminal Sequence AVPI
Purity Confirmation > 97.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Rabbit
Formulation lyophilized
Protein Sequence AVPMRKVQDDTKTLIKTIVTRISDISHTQSVSSRQRVVGLDFIPGLHPNLSLSTMDQTLAIYQQILASLPSRNVIQIANDLENLRDLLHLLASSKSCPLPRASGLETLEGLGGVLEASLYSTEVVALSRLQGFLQAMLQQLDLGPGC
Reconstitution It is recommended to reconstitute the lyophilized recombinant rabbit leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Lep; ob; obese
Uniprot ID B0KZL0
Protein RefSeq NP_001156541.1
mRNA RefSeq NM_001163069.1

All prices plus VAT + possible delivery charges