rabbit Leptin protein Rabbit 100 µg
Description / rabbit Leptin protein
Recombinant rabbit leptin, is one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Recombinant rabbit leptin was purified by proprietary chromatographic techniques, (Solomon, Charlier, Djiane and Gertler,. unpublished results)
More Information
| Size | 100 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant rabbit leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. |
| N Terminal Sequence | AVPI |
| Purity Confirmation | > 97.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| Species Reactivity | Rabbit |
| Formulation | lyophilized |
| Protein Sequence | AVPMRKVQDDTKTLIKTIVTRISDISHTQSVSSRQRVVGLDFIPGLHPNLSLSTMDQTLAIYQQILASLPSRNVIQIANDLENLRDLLHLLASSKSCPLPRASGLETLEGLGGVLEASLYSTEVVALSRLQGFLQAMLQQLDLGPGC |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant rabbit leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Uniprot ID | B0KZL0 |
| Protein RefSeq | NP_001156541.1 |
| mRNA RefSeq | NM_001163069.1 |

