porcine Leptin protein Porcine 100 µg

In stock

Cat-Nr.
500-070
Size
100 µg
  €368.00

Description / porcine Leptin protein

Recombinant porcine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, Recombinant porcine leptin was purified by proprietary chromatographic techniques, see Raver et al. Prot. Express. Purif. 19, 30-40 (2000).

More Information

Size 100 µg
Source E. coli
Biological Activity Recombinant porcine leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor.
N Terminal Sequence AVIPW
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 146
Molecular Weight 16.0 kDa
Species Reactivity Porcine
Formulation lyophilized
Protein Sequence AVPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC
Reconstitution It is recommended to reconstitute the lyophilized recombinant porcine leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Lep; ob; obese
Uniprot ID Q29406
Protein RefSeq NP_999005.1
mRNA RefSeq NM_213840.1

All prices plus VAT + possible delivery charges