ovine Leptin protein Ovine 20 µg
Description / ovine Leptin protein
Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, Recombinant ovine leptin was purified by proprietary chromatographic techniques, see Gertler et al. FEBS Lett. 442, 137-140 (1998).
More Information
| Size | 20 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant ovine leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. |
| N Terminal Sequence | AVPIR |
| Purity Confirmation | > 95.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| Species Reactivity | Ovine |
| Formulation | lyophilized |
| Protein Sequence | AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant ovine leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Protein RefSeq | XP_027824581.2 |
| mRNA RefSeq | XM_027968780.2 |

