Description / human Lactogen, placental protein
Recombinant human placental lactogen, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 22.4 kDa, was purified by proprietary chromatographic techniques.
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant human PL is fully biologically active as evidenced by inducing proliferation of Nb2 cells. |
| N Terminal Sequence | AVQTVP |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 192 |
| Molecular Weight | 22.4 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | AVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
| Reconstitution | It is recommended to reconstitute the lyophilized hPL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
| Synonyms | Chorionic somatomammotropin hormone 1, Choriomammotropin, Placental lactogen (PL) |
| Uniprot ID | P0DML2 |
| Protein RefSeq | NP_001308.1 |
| mRNA RefSeq | NM_001317.6 |

