human Lactogen, placental protein Human 10 µg

In stock

Cat-Nr.
500-035S
Size
10 µg
€200.00

Description / human Lactogen, placental protein

Recombinant human placental lactogen, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 22.4 kDa, was purified by proprietary chromatographic techniques.

More Information

Size 10 µg
Source E. coli
Biological Activity Recombinant human PL is fully biologically active as evidenced by inducing proliferation of Nb2 cells.
N Terminal Sequence AVQTVP
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 192
Molecular Weight 22.4 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence AVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Reconstitution It is recommended to reconstitute the lyophilized hPL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Synonyms Chorionic somatomammotropin hormone 1, Choriomammotropin, Placental lactogen (PL)
Uniprot ID P0DML2
Protein RefSeq NP_001308.1
mRNA RefSeq NM_001317.6

All prices plus VAT + possible delivery charges