human Lactogen, placental protein Human 1000 µg

Cat-Nr.
500-035-L1000
Size
1000 µg
€2,807.00

Description / human Lactogen, placental protein

Placental Lactogen or Chorionic Somatomammotropin Hormone 1 is a polypeptide hormone belonging to the somatropin/prolactin family of hormones. Placental Lactogen has both Growth Hormone and Prolactin activities, such as stimulating lactation, fetal growth and luteal steroid production. Placental Lactogen is expressed mainly in the placenta soon after implantation and the secretion of the hormone increases to 1 g or more a day in late pregnancy. The Placental Lactogen sequence only differs from Chorionic Somatomammotropin Hormone 2 (CSH2) sequence in one amino acid, which is also upregulated during development. Mutations in gene encoding Placental Lactogen result in the Silver-Russell syndrome. Recombinant Human Placental Lactogen is a singular polypeptide chain containing 200 amino acid residues including an additional Ala at N-terminus and has a molecular weight of approx. 22.4 kDa.

More Information

Size 1000 µg
Source E. coli
Biological Activity The biological activity is determined by the stimulation of proliferation of Nb2 cells.
N Terminal Sequence AVQTVP
Purity Confirmation > 99.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 200
Molecular Weight 22.4 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence AVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Reconstitution Centrifuge the vial prior to opening. Do not vortex. The lyophilized Lactogen should be reconstituted in sterile water or 0.4 % NaHCO3 (pH 8-9) to a concentration not lower than 0.1 mg/mL.
Stability and Storage Lyophilized samples are stable at room temperature for 3 weeks or 1 year when stored at -20°C. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.
Synonyms Chorionic somatomammotropin hormone 1, CSH1, Choriomammotropin, Placental lactogen, PL
Uniprot ID P0DML2
Protein RefSeq NP_001308.1
mRNA RefSeq NM_001317.6

All prices plus VAT + possible delivery charges