yeast Kex-2 protein Yeast 1000 µg

In stock

Cat-Nr.
100-415-L1000
Size
1000 µg
€659.00

Description / yeast Kex-2 protein

Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at or adjacent to specific residues or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes including prenatal and postnatal development, reproduction, signal transduction, the immune response, various autoimmune and degenerative diseases, and cancer. They are also an important research tool, frequently used in the analysis and production of proteins. Kex-2 cleaves at the carboxyl end of the recognition sequences Arg-Arg/X and Lys-Arg/X. Recombinant Yeast Kex-2 is a 60.4 kDa protease consisting of 558 amino acid residues.

More Information

Size 1000 µg
Source Insect cells
Biological Activity Recombinant Kex-2 from High-5 insect cells contains the same specific activity and recognition sequence specificity as yeast derived KEX-2. 1 milligram of recombinant KEX-2 contains activity equivalent to at least 40 units of yeast derived KEX-2. Cleaves
Purity Confirmation > 95% by SDS-PAGE & HPLC analyses
Length [aa] 558
Molecular Weight 60.4 kDa
Formulation lyophilized
Buffer 10mM Sodium Acetate, pH 6.0 + 5mM CaCl
Protein Sequence LPVPAPPMDSSLLPVKEAEDKLSINDPLFERQWHLVNPSFPGSDINVLDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLDVNDIYSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSEGCSAVMAVTYSSGS
Reconstitution Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carri
Stability and Storage The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 12 months at -20°C to -80°C.
Synonyms Endoproteinase Lys/Arg-Arg, Protease KEX2, Proteinase YSCF
Uniprot ID P13134
Protein RefSeq NP_014161.1
mRNA RefSeq NM_001183076.1

All prices plus VAT + possible delivery charges