mouse IP-10 (CXCL10) protein Mouse 100 µg

In stock

Cat-Nr.
M10-025-L100
Size
100 µg
  €661.00

Description / mouse IP-10 (CXCL10) protein

Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues.

More Information

Size 100 µg
Source E. coli
Biological Activity Assay #1: Determined by its ability to chemoattract IL-2 activated T cells using a concentration range of 0.1-10.0 ng/ml. Assay #2: Determined by its ability to chemoattract CXCR3 transfected/HEK293 cells using a concentration range of 100-500 ng/ml.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 77
Molecular Weight 8.7 kDa
Species Reactivity Human, Mouse, Rat, Monkey
Formulation lyophilized
Protein Sequence IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Synonyms Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
Uniprot ID P17515
Protein RefSeq NP_067249.1
mRNA RefSeq NM_021274.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-P21
€283.00

In stock

All prices plus VAT + possible delivery charges