Description / human IP-10 (CXCL10) protein
IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.
More Information
| Size | 500 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml. |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 77 |
| Molecular Weight | 8.6 kDa |
| Species Reactivity | Monkey, Mouse, Leech, Human |
| Formulation | lyophilized |
| Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Synonyms | CXCL10 |
| Uniprot ID | P02778 |
| Protein RefSeq | NP_001556.2 |
| mRNA RefSeq | NM_001565.3 |

