human IP-10 (CXCL10) protein Human 25 µg

In stock

Cat-Nr.
100-057
Size
25 µg
€217.00

Description / human IP-10 (CXCL10) protein

IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.

More Information

Size 25 µg
Source E. coli
Biological Activity Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 77
Molecular Weight 8.6 kDa
Species Reactivity Monkey, Mouse, Leech, Human
Formulation lyophilized
Protein Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Synonyms CXCL10
Uniprot ID P02778
Protein RefSeq NP_001556.2
mRNA RefSeq NM_001565.3

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P48
€283.00

In stock

All prices plus VAT + possible delivery charges