human IL-6 protein Human 50 µg

In stock

Cat-Nr.
200-030-DC
Size
50 µg
  €316.00

Description / human IL-6 protein

Interleukin 6 (IL-6) is a pleiotropic α-helical cytokine that plays important roles in acute phase reactions, inflammation, hematopoiesis, bone metabolism, and cancer progression. IL-6 activity is essential for the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. It is secreted by multiple cell types as a 22 kDa-28 kDa phosphorylated and variably glycosylated molecule. Mature human IL6 is 183 amino acids (aa) in length and shares 41% aa sequence identity with mouse and rat IL-6. Alternate splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. Human IL6 is equally active on mouse and rat cells. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL6 R) and a signal transducing subunit (gp130). IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130expressing cells that lack cell surface IL-6 R. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/ IL-6 R but not from other cytokines that utilize gp130 as a co-receptor.

More Information

Size 50 µg
Source E. coli
Biological Activity The ED50 as determined by the dose-dependent stimulation of murine hybridoma B9 cells is in the range of 2 - 10 pg/mL.
N Terminal Sequence MAPVPPGE
Purity Confirmation > 98% by SDS-PAGE
Length [aa] 186
Molecular Weight 21.1 kDa
Species Reactivity Human
Formulation lyophilized (freeze-dried)
Buffer PBS
Protein Sequence MAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Reconstitution The lyophilized IL-6 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
Stability and Storage The lyophilized IL-6, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-6 should be stored in working aliquots at -20°C.
Synonyms IL6; HGF; HSF; BSF2; IL-6; IFNB2
Uniprot ID P05231
Protein RefSeq NP_000591
mRNA RefSeq NM_000600

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P153G
€283.00

In stock

SKU: 101-M06
€183.00

In stock

SKU: 101-M793
€453.00

In stock

SKU: 101-M794
€453.00

In stock

SKU: 101-M795
€453.00

In stock

SKU: 102-P36
€283.00

In stock

All prices plus VAT + possible delivery charges