human IL-6 protein Human 50 µg
Description / human IL-6 protein
Interleukin 6 (IL-6) is a pleiotropic α-helical cytokine that plays important roles in acute phase reactions, inflammation, hematopoiesis, bone metabolism, and cancer progression. IL-6 activity is essential for the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. It is secreted by multiple cell types as a 22 kDa-28 kDa phosphorylated and variably glycosylated molecule. Mature human IL6 is 183 amino acids (aa) in length and shares 41% aa sequence identity with mouse and rat IL-6. Alternate splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. Human IL6 is equally active on mouse and rat cells. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL6 R) and a signal transducing subunit (gp130). IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130expressing cells that lack cell surface IL-6 R. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/ IL-6 R but not from other cytokines that utilize gp130 as a co-receptor.
More Information
| Size | 50 µg |
|---|---|
| Source | E. coli |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of murine hybridoma B9 cells is in the range of 2 - 10 pg/mL. |
| N Terminal Sequence | MAPVPPGE |
| Purity Confirmation | > 98% by SDS-PAGE |
| Length [aa] | 186 |
| Molecular Weight | 21.1 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized (freeze-dried) |
| Buffer | PBS |
| Protein Sequence | MAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Reconstitution | The lyophilized IL-6 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. |
| Stability and Storage | The lyophilized IL-6, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-6 should be stored in working aliquots at -20°C. |
| Synonyms | IL6; HGF; HSF; BSF2; IL-6; IFNB2 |
| Uniprot ID | P05231 |
| Protein RefSeq | NP_000591 |
| mRNA RefSeq | NM_000600 |

