Description / human IL-4 protein
IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant human IL-4 is a 14.9 kDa globular protein containing 130 amino acid residues
More Information
| Size | 50 µg |
|---|---|
| Source | E. coli |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of human TF-1 cells is 0.1-0.5ng/ml. |
| N Terminal Sequence | MHKCDITL |
| Purity Confirmation | > 98% by SDS-PAGE |
| Length [aa] | 130 |
| Molecular Weight | 14.9 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | PBS |
| Protein Sequence | MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
| Reconstitution | The lyophilized IL-4 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. |
| Stability and Storage | The lyophilized IL-4, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles. |
| Synonyms | IL4; BSF1; IL-4; BCGF1; BSF-1; BCGF-1 |
| Uniprot ID | P05112 |
| Protein RefSeq | NP_000580 |
| mRNA RefSeq | NM_000589 |

