human IL-4 protein Human 10 µg

In stock

Cat-Nr.
200-022
Size
10 µg
€136.00

Description / human IL-4 protein

IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant human IL-4 is a 14.9 kDa globular protein containing 130 amino acid residues

More Information

Size 10 µg
Source E. coli
Biological Activity The ED50 as determined by the dose-dependent stimulation of human TF-1 cells is 0.1-0.5ng/ml.
N Terminal Sequence MHKCDITL
Purity Confirmation > 98% by SDS-PAGE
Length [aa] 130
Molecular Weight 14.9 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Reconstitution The lyophilized IL-4 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
Stability and Storage The lyophilized IL-4, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.
Synonyms IL4; BSF1; IL-4; BCGF1; BSF-1; BCGF-1
Uniprot ID P05112
Protein RefSeq NP_000580
mRNA RefSeq NM_000589

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M05
€183.00

In stock

SKU: 101-M508
€453.00

In stock

SKU: 102-P34
€283.00

In stock

All prices plus VAT + possible delivery charges