human IL-36RA protein Human 250 µg

In stock

Cat-Nr.
100-414-L250
Size
250 µg
€1,160.00

Description / human IL-36RA protein

The IL-1 family is comprised of 11 structurally related ligands, including the recently re-named IL-36RA (IL-1F5), IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). The interaction of IL-36 ligands with the IL-1Rrp2 receptor (IL-1R6) can induce various activities, including dendritic cell maturation and activation. IL-36RA can antagonize the NF-kappaB signaling induced by either IL-36α, -β or -γ by binding to the IL-1Rrp2 receptor in a manner that prevents the initiation of functional signaling. Recombinant human IL-36RA is an E. coli derived 17 kDa protein containing 154 amino acid residues.

More Information

Size 250 µg
Source E. coli
Biological Activity Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 154
Molecular Weight 17 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Synonyms FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra homolog 1, IL-1 delta
Uniprot ID Q9UBH0
Protein RefSeq NP_036407.1
mRNA RefSeq NM_012275.2

All prices plus VAT + possible delivery charges