human IL-36RA protein Human 5 µg

In stock

Cat-Nr.
100-414S
Size
5 µg
€90.00

Description / human IL-36RA protein

The IL-1 family is comprised of 11 structurally related ligands, including the recently re-named IL-36RA (IL-1F5), IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). The interaction of IL-36 ligands with the IL-1Rrp2 receptor (IL-1R6) can induce various activities, including dendritic cell maturation and activation. IL-36RA can antagonize the NF-kappaB signaling induced by either IL-36α, -β or -γ by binding to the IL-1Rrp2 receptor in a manner that prevents the initiation of functional signaling. Recombinant human IL-36RA is an E. coli derived 17 kDa protein containing 154 amino acid residues.

More Information

Size 5 µg
Source E. coli
Biological Activity Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 154
Molecular Weight 17 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Synonyms FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra homolog 1, IL-1 delta
Uniprot ID Q9UBH0
Protein RefSeq NP_036407.1
mRNA RefSeq NM_012275.2

All prices plus VAT + possible delivery charges