Description / human IL-36RA protein
The IL-1 family is comprised of 11 structurally related ligands, including the recently re-named IL-36RA (IL-1F5), IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). The interaction of IL-36 ligands with the IL-1Rrp2 receptor (IL-1R6) can induce various activities, including dendritic cell maturation and activation. IL-36RA can antagonize the NF-kappaB signaling induced by either IL-36α, -β or -γ by binding to the IL-1Rrp2 receptor in a manner that prevents the initiation of functional signaling. Recombinant human IL-36RA is an E. coli derived 17 kDa protein containing 154 amino acid residues.
More Information
Size | 25 µg |
---|---|
Source | E. coli |
Biological Activity | Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs. |
Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
Length [aa] | 154 |
Molecular Weight | 17 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Protein Sequence | VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
Synonyms | FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra homolog 1, IL-1 delta |
Uniprot ID | Q9UBH0 |
Protein RefSeq | NP_036407.1 |
mRNA RefSeq | NM_012275.2 |