human IL-3 protein Human 10 µg
Description / human IL-3 protein
IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoiesis, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. Recombinant human IL-3 is a 15.0 kDa globular protein containing 134 amino acid residues.
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 0.1 – 0.5 ng/ml. The WHO standard #91/510 was used as a control. |
| N Terminal Sequence | MAPMTQT |
| Purity Confirmation | >98% by SDS-PAGE |
| Length [aa] | 134 |
| Molecular Weight | 15.0 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | PBS |
| Protein Sequence | MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Reconstitution | The lyophilized IL-3 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. |
| Stability and Storage | The lyophilized IL-3, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-3 should be stored in working aliquots at -20°C. |
| Synonyms | IL3; IL-3; MCGF; MULTI-CSF |
| Uniprot ID | P08700 |
| Protein RefSeq | NP_000579 |
| mRNA RefSeq | NM_000588 |

