human IL-3 protein Human 10 µg

In stock

Cat-Nr.
200-016
Size
10 µg
  €136.00

Description / human IL-3 protein

IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoiesis, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. Recombinant human IL-3 is a 15.0 kDa globular protein containing 134 amino acid residues.

More Information

Size 10 µg
Source E. coli
Biological Activity The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 0.1 – 0.5 ng/ml. The WHO standard #91/510 was used as a control.
N Terminal Sequence MAPMTQT
Purity Confirmation >98% by SDS-PAGE
Length [aa] 134
Molecular Weight 15.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Reconstitution The lyophilized IL-3 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
Stability and Storage The lyophilized IL-3, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-3 should be stored in working aliquots at -20°C.
Synonyms IL3; IL-3; MCGF; MULTI-CSF
Uniprot ID P08700
Protein RefSeq NP_000579
mRNA RefSeq NM_000588

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P33
€283.00

In stock

All prices plus VAT + possible delivery charges