mouse IL-22 receptor antagonist (Y51A), pegylated protein Mouse 2 µg
Description / mouse IL-22 receptor antagonist (Y51A), pegylated protein
Mono-pegylated (with 20 kDa PEG)recombinant mouse interleukin 22 Y51A mutant (numbering according to human IL-22 including signal peptide) is one polypeptide chain containing 147 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 36 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SDS-PAGE as 50 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. For more details see L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012).
More Information
| Size | 2 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant murine IL-22 Y51A mutant is biologically active, capable of full inhibition of mouse IL-22 induced STAT3 phosphorylation in HepG cells. Its inhibitory acrtivity in vitro is ~ 10-20% compared to the non-pegylated mIL22 (Y51A) mutant. |
| N Terminal Sequence | ALPVN |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 147 |
| Molecular Weight | 16.7 kDa |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Protein Sequence | ALPVNTRCKLEVSNFQQPAIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV |
| Reconstitution | It is recommended to reconstitute the lyophilized pegylated mouse IL22 Y51A in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | IL22; IL-22; Iltif; IL-22a; ILTIFa |
| Uniprot ID | Q9JJY9 |
| Protein RefSeq | NP_058667.1 |
| mRNA RefSeq | NM_016971 |

