mouse IL-22 receptor antagonist (Y51A), pegylated protein Mouse 2 µg

In stock

Cat-Nr.
500-034S
Size
2 µg
€181.00

Description / mouse IL-22 receptor antagonist (Y51A), pegylated protein

Mono-pegylated (with 20 kDa PEG)recombinant mouse interleukin 22 Y51A mutant (numbering according to human IL-22 including signal peptide) is one polypeptide chain containing 147 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 36 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SDS-PAGE as 50 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. For more details see L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012).

More Information

Size 2 µg
Source E. coli
Biological Activity Recombinant murine IL-22 Y51A mutant is biologically active, capable of full inhibition of mouse IL-22 induced STAT3 phosphorylation in HepG cells. Its inhibitory acrtivity in vitro is ~ 10-20% compared to the non-pegylated mIL22 (Y51A) mutant.
N Terminal Sequence ALPVN
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 147
Molecular Weight 16.7 kDa
Species Reactivity Mouse
Formulation lyophilized
Protein Sequence ALPVNTRCKLEVSNFQQPAIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Reconstitution It is recommended to reconstitute the lyophilized pegylated mouse IL22 Y51A in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
Synonyms IL22; IL-22; Iltif; IL-22a; ILTIFa
Uniprot ID Q9JJY9
Protein RefSeq NP_058667.1
mRNA RefSeq NM_016971

All prices plus VAT + possible delivery charges