human IL-22 receptor antagonist (Y51A) protein Human 1000 µg

In stock

Cat-Nr.
500-027-L1000
Size
1000 µg
€4,500.00

Description / human IL-22 receptor antagonist (Y51A) protein

IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-beta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant human IL-22 mutant Y51A (numbering according to human IL-22 including signal peptide) produced in E.Coli is a single, non-glycosylated polypeptide chain containing 147 amino acids and having a molecular mass of 16.7 kDa. Preparation of recombinant hIL-22 antagonists provides new tools for the study of IL-22 activity and of eventual therapeutic means for attenuating its negative effects. It was prepared similarly to that described by L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012).

More Information

Size 1000 µg
Source E. coli
Biological Activity Recombinant human IL-22 Y51A mutant is capable of full inhibition of STAT3 phosphorylation induced by mouse interleukin 22 in HepG cells. Its affinity toward immobilized mIL-22 receptor α1 extracellular domain (mIL-22 Rα1-ECD) or IL-22 binding protein is
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 147
Molecular Weight 16.7 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence AAPISSHCRLDKSNFQQPAITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Reconstitution It is recommended to reconstitute the lyophilized IL-22 Y51A in sterile H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions containing carrier protein such as BSA, HSA or similar.
Synonyms I-TIF
Uniprot ID Q9GZX6
Protein RefSeq NP_065386.1
mRNA RefSeq NM_020525.4

All prices plus VAT + possible delivery charges