mouse IL-10 protein Mouse 1000 µg
Description / mouse IL-10 protein
Interleukin 10 (IL-10), initially designated cytokine synthesis inhibitory factor (CSIF), was originally identified as a product of mouse T helper (Th) 2 clones that inhibited cytokine production by Th1 clones . The human ortholog of mouse IL-10 was subsequently cloned by cross-hybridization. Human and mouse IL-10 are 81% identical at the nucleotide and amino acid level. IL-10 is the prototypic member of the IL-10 cytokine family, including IL-10, IL-19, IL-20, IL-22 (IL-TIF), IL-24 and IL-26. A number of viruses, including Epstein-Barr virus (EBV) and human cytomegalovirus (HCMV), also encode viral members of the IL-10 family. Human IL-10 has cross-species actvity and is active on mouse cells. Mouse IL-10 is species-specific and does not act on human cells.
More Information
| Size | 1000 µg |
|---|---|
| Source | E. coli |
| Biological Activity | The biologically activity was measured by the dose-dependent co-stimulation (with IL-4) of the proliferation of murine MC/9 cells. The ED50 was found to be < 2 ng/ml (> 5 x 105 units/mg). |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 160 |
| Molecular Weight | 18.8 kDa |
| Species Reactivity | Human, Rat, Mouse |
| Formulation | lyophilized |
| Protein Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS |
| Synonyms | Il10; CSIF; Il-10 |
| Uniprot ID | P18893 |
| Protein RefSeq | NP_034678 |
| mRNA RefSeq | NM_010548 |

