mouse IL-10 protein Mouse 100 µg

In stock

Cat-Nr.
M10-020-L100
Size
100 µg
  €1,112.00

Description / mouse IL-10 protein

Interleukin 10 (IL-10), initially designated cytokine synthesis inhibitory factor (CSIF), was originally identified as a product of mouse T helper (Th) 2 clones that inhibited cytokine production by Th1 clones . The human ortholog of mouse IL-10 was subsequently cloned by cross-hybridization. Human and mouse IL-10 are 81% identical at the nucleotide and amino acid level. IL-10 is the prototypic member of the IL-10 cytokine family, including IL-10, IL-19, IL-20, IL-22 (IL-TIF), IL-24 and IL-26. A number of viruses, including Epstein-Barr virus (EBV) and human cytomegalovirus (HCMV), also encode viral members of the IL-10 family. Human IL-10 has cross-species actvity and is active on mouse cells. Mouse IL-10 is species-specific and does not act on human cells.

More Information

Size 100 µg
Source E. coli
Biological Activity The biologically activity was measured by the dose-dependent co-stimulation (with IL-4) of the proliferation of murine MC/9 cells. The ED50 was found to be < 2 ng/ml (> 5 x 105 units/mg).
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 160
Molecular Weight 18.8 kDa
Species Reactivity Human, Rat, Mouse
Formulation lyophilized
Protein Sequence SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS
Synonyms Il10; CSIF; Il-10
Uniprot ID P18893
Protein RefSeq NP_034678
mRNA RefSeq NM_010548

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-P18
€271.00

In stock

SKU: 103-M202
€275.00

In stock

All prices plus VAT + possible delivery charges