human IL-1 beta protein Human 10 µg

In stock

Cat-Nr.
400-002
Size
10 µg
  €136.00

Description / human IL-1 beta protein

Interleukin-1 beta (IL-1beta) is produced by activated macrophages. IL-1beta stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1beta proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL1F1) and IL1 beta (IL1F2), which are the products of distinct genes. IL- 1 alpha and IL-1 beta are structurally related polypeptides that share approximately 21% amino acid (aa) identity in human. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. The human IL-1 beta cDNA encodes a 269 aa precursor. A 116 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta converting enzyme (Caspase1/ICE) to generate the active cytokine. The mature human IL-1 beta shares 96% aa sequence identity with rhesus and 67% 78% with canine, cotton rat, equine, feline, mouse, porcine, and rat IL-1 beta. Human recombinant IL-1beta produced in E. coli is a non-glycosylated, IL-1 beta polypeptide chain containing 153 amino acids and having a molecular mass of 17.0 kDa.

More Information

Size 10 µg
Source E. coli
Biological Activity Measured in a cell proliferation assay using murine D10G4.1 cells. The ED50 for this effect is typically 2-10 pg/ml.
N Terminal Sequence APVRSL and MAPVRS
Purity Confirmation > 98% by SDS-PAGE
Length [aa] 153
Molecular Weight 17.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Reconstitution The lyophilized rh IL-1ß is soluble in water and most aqueous buffers and can be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
Stability and Storage Lyophilized IL-1ß although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1ß should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a
Synonyms IL1B; IL-1; IL1F2; IL1-BETA
Uniprot ID P01584
Protein RefSeq NP_000567
mRNA RefSeq NM_000576

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P08G
€283.00

In stock

All prices plus VAT + possible delivery charges