rat IGF-1 protein Rat 1000 µg

In stock

Cat-Nr.
500-025-L1000
Size
1000 µg
  €1,203.00

Description / rat IGF-1 protein

IGF-1 is a small protein secreted mainly but not solely by the liver and circulating in blood mostly as a complex with various IGF binding proteins in the blood. It has growth-regulating, insulin-like, and mitogenic activities and it is secreted in response to growth hormone stimulation. Recombinant rat IGF-I produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 7.6 kDa.

More Information

Size 1000 µg
Source E. coli
Biological Activity The ED50 as determined by the stimulation of protein synthesis in rat L6 myoblasts was found to be < 30ng/ml corresponding to a Specific Activity of 33,334IU/mg.
Purity Confirmation >98.0% as determined by SDS-PAGE
Length [aa] 71
Molecular Weight 7.6 kDa
Species Reactivity Rat
Formulation lyophilized
Protein Sequence MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
Reconstitution It is recommended to reconstitute the lyophilized rIGF-I in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Igf1; Igf-1; Igf-I; C730016P09Rik
Uniprot ID P08025
Protein RefSeq NP_001075948.1
mRNA RefSeq NM_001082479.1

All prices plus VAT + possible delivery charges