Description / rat IGF-1 protein
IGF-1 is a small protein secreted mainly but not solely by the liver and circulating in blood mostly as a complex with various IGF binding proteins in the blood. It has growth-regulating, insulin-like, and mitogenic activities and it is secreted in response to growth hormone stimulation. Recombinant rat IGF-I produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 7.6 kDa.
More Information
| Size | 1000 µg |
|---|---|
| Source | E. coli |
| Biological Activity | The ED50 as determined by the stimulation of protein synthesis in rat L6 myoblasts was found to be < 30ng/ml corresponding to a Specific Activity of 33,334IU/mg. |
| Purity Confirmation | >98.0% as determined by SDS-PAGE |
| Length [aa] | 71 |
| Molecular Weight | 7.6 kDa |
| Species Reactivity | Rat |
| Formulation | lyophilized |
| Protein Sequence | MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA |
| Reconstitution | It is recommended to reconstitute the lyophilized rIGF-I in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Igf1; Igf-1; Igf-I; C730016P09Rik |
| Uniprot ID | P08025 |
| Protein RefSeq | NP_001075948.1 |
| mRNA RefSeq | NM_001082479.1 |