rabbit IGF-1 protein Rabbit 10 µg
Description / rabbit IGF-1 protein
IGF-1 is a small protein secreted mainly but not solely by the liver and circulating in blood mostly as a complex with various IGF binding proteins in the blood. It has growth-regulating, insulin-like, and mitogenic activities and it is secreted in response to growth hormone stimulation. Recombinant rabbit IGF-I produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 7639 Dalton.
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | rbIGF-I is biologically active when compared to human IGF-1. The ED50, calculated by the dose -dependent proliferation of human MCF/7 cells is 5 to 25 ng/ml in the cell culture mixture dependent on culture conditions. Its activity consisits of 30-40 % com |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 72 |
| Molecular Weight | 7.6 kDa |
| Species Reactivity | Rabbit |
| Formulation | lyophilized |
| Protein Sequence | MTGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKAA |
| Reconstitution | It is recommended to reconstitute the lyophilized rbIGF-I in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Igf1; Igf-1; Igf-I; C730016P09Rik |
| Uniprot ID | Q95222 |
| Protein RefSeq | NP_001075495.1 |
| mRNA RefSeq | NM_001082026.1 |

